PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 416aa    MW: 45763.4 Da    PI: 8.1743
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08106genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-1784128147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+eE++++++a +++G   W++I +++g ++t+ q++s+ qk+
         EMT08106  84 REKWTEEEHKRFLEALQLHGRA-WRRIQEHIG-TKTAVQIRSHAQKF 128
                      789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.91E-1678132IPR009057Homeodomain-like
PROSITE profilePS5129420.54279133IPR017930Myb domain
TIGRFAMsTIGR015579.5E-1682131IPR006447Myb domain, plants
SMARTSM007174.3E-1383131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-984124IPR009057Homeodomain-like
PfamPF002498.5E-1584127IPR001005SANT/Myb domain
CDDcd001672.15E-1086129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MAMFVAPERL SLGQVHKDFP AVIDKVRPAP AWERRHRRWP ENAMATDEST ADHRGSRPSS  60
HDMDLSGDDH VPKARKPYTI TKQREKWTEE EHKRFLEALQ LHGRAWRRIQ EHIGTKTAVQ  120
IRSHAQKFFS KASEFTANGD VKEGSCTGSA TSVLKLFGKK VVVNDSFQKP NTSTGNPQNG  180
GDVGTEASDD TTTQGSRNLP SGGATEGSSW NPWPSSMQQF VYFVPQPDGF ATQSAVPWFG  240
TLPGAMFYQQ AMAPNQHQRH RSETADHKFM QREGSWTGSN TGPGSAAHNS DAADSRGRGN  300
SSESDKTPVP RLTKCESSVS VSLQRGFMPY KRCAAESESL RSEAPREETD APTGLGRRQQ  360
AAQVRHATEG RCVAVELCES GEELAGRGSF KTSRSDQEGN ANESTLQTCI RVLTSE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0094060.0BT009406.1 Triticum aestivum clone wlm96.pk054.b21:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572833.21e-115PREDICTED: myb-like protein H
TrEMBLM8B2730.0M8B273_AEGTA; Myb-like protein G
STRINGBRADI3G51960.11e-114(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-35MYB_related family protein